Loading...
Statistics
Advertisement

Nnpwy.com

Advertisement
Conversion Technology Metas Server
Nnpwy.com is hosted in United States / Cheyenne . Nnpwy.com doesn't use HTTPS protocol. Number of used technologies: 4. First technologies: CSS, Html, Iframe, Number of used javascripts: 5. First javascripts: Jquery.min.js, Common.js, Check.js, Number of used analytics tools: 0. Its server type is: NetBox Version 2.8 Build 4128.

Technologies in use by Nnpwy.com

Technology

Number of occurences: 4
  • CSS
  • Html
  • Iframe
  • Javascript

Advertisement

Javascripts

Number of occurences: 5
  • jquery.min.js
  • common.js
  • check.js
  • check_password.js
  • dna_4.js

Server Type

  • NetBox Version 2.8 Build 4128

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Nnpwy.com

Missing HTTPS protocol.

    Meta - Nnpwy.com

    Number of occurences: 1
    • Name:
      Content: IE=EmulateIE7

    Server / Hosting

    • IP: 69.165.77.4
    • Latitude: 41.33
    • Longitude: -104.67
    • Country: United States
    • City: Cheyenne

    Rname

    • f1g1ns2.dnspod.net
    • f1g1ns1.dnspod.net

    Target

    • freednsadmin.dnspod.com

    HTTP Header Response

    HTTP/1.1 302 Found Server: NetBox Version 2.8 Build 4128 Date: Wed, 05 Oct 2016 05:04:42 GMT Set-Cookie: JUBKGTRQNOEQVRFZWMVU=PBSEIIWLOJDSVAMALSCDNGYYIGRIHKMGTMKMVEKP; path=/ Location: index_f.asp Cache-Control: private Content-Type: text/html Content-Length: 0 X-Cache: MISS from s_sh11 Via: 1.1 s_sh11 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 OK Server: NetBox Version 2.8 Build 4128 Date: Wed, 05 Oct 2016 05:04:42 GMT Set-Cookie: JUBKGTRQNOEQVRFZWMVU=AEYWOXOQOPUHRARTAFZFDZUNGGAKWIZYVSYTFKOQ; path=/ Cache-Control: private Content-Type: text/html Content-Length: 9621 X-Cache: MISS from s_sh11 Via: 1.1 s_sh11 (squid/3.5.20) Connection: keep-alive

    DNS

    host: nnpwy.com
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 69.165.77.4
    host: nnpwy.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: f1g1ns2.dnspod.net
    host: nnpwy.com
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: f1g1ns1.dnspod.net
    host: nnpwy.com
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: f1g1ns1.dnspod.net
    5. rname: freednsadmin.dnspod.com
    6. serial: 1472292204
    7. refresh: 3600
    8. retry: 180
    9. expire: 1209600
    10. minimum-ttl: 180

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.npwy.com, www.nnnpwy.com, www.nnpwy.com, www.nhnpwy.com, www.hnpwy.com, www.njnpwy.com, www.jnpwy.com, www.nknpwy.com, www.knpwy.com, www.nlnpwy.com, www.lnpwy.com, www.n npwy.com, www. npwy.com, www.npwy.com, www.nnnpwy.com, www.nnpwy.com, www.nnhpwy.com, www.nhpwy.com, www.nnjpwy.com, www.njpwy.com, www.nnkpwy.com, www.nkpwy.com, www.nnlpwy.com, www.nlpwy.com, www.nn pwy.com, www.n pwy.com, www.nnwy.com, www.nnpiwy.com, www.nniwy.com, www.nnpkwy.com, www.nnkwy.com, www.nnpuwy.com, www.nnuwy.com, www.nnpjwy.com, www.nnjwy.com, www.nnplwy.com, www.nnlwy.com, www.nnpy.com, www.nnpw y.com, www.nnp y.com, www.nnpwcy.com, www.nnpcy.com, www.nnpwy.com, www.nnpy.com, www.nnpwdy.com, www.nnpdy.com, www.nnpwfy.com, www.nnpfy.com, www.nnpwgy.com, www.nnpgy.com, www.nnpwby.com, www.nnpby.com, www.nnpw.com, www.nnpwyz.com, www.nnpwz.com, www.nnpwya.com, www.nnpwa.com, www.nnpwys.com, www.nnpws.com, www.nnpwyd.com, www.nnpwd.com, www.nnpwy.com, www.nnpw.com, www.nnpwyc.com, www.nnpwc.com, www.nnpwy .com, www.nnpw .com,

    Other websites we recently analyzed

    1. 九五至尊 - 老品牌值得信赖！！
      Kwun Tong (Hong Kong) - 123.60.181.208
      Server software: nginx
      Technology: Html, Iframe, Javascript
      Number of Javascript: 1
      Number of meta tags: 1
    2. Courtly Noyse
      Early Music instrumental and Vocal ensemble
      Colorado Springs (United States) - 69.73.144.31
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    3. index
      Denmark - 46.30.213.101
      Server software: Apache
      Technology: Html, Swf Object
      Number of Javascript: 1
      Number of meta tags: 1
    4. Security Innovation Network | SINET HOME
      Ashland (United States) - 66.241.70.141
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript, jQuery, jQuery Validate, Swf Object, Google Analytics, Twitter Button
      Number of Javascript: 10
      Number of meta tags: 2
    5. revesencadeau.fr
      France - 217.26.192.173
      Server software: Apache
      Technology: Html
    6. Finazzo Cossolini O'Leary Meola & Hager, LLC
      Englewood (United States) - 207.111.78.76
      Server software: Apache/1.3.34 (Unix) PHP/4.4.8 mod_jk/1.2.23 mod_perl/1.29 mod_ssl/2.8.25 OpenSSL/0.9.7a
      Technology: CSS, Html, Javascript
      Number of Javascript: 4
      Number of meta tags: 1
    7. Welcome to ValueSetters, Inc » ValueSetters
      Vaxstar is a next generation Music, Movies and Media Entertainment company
      Ashburn (United States) - 23.21.147.51
      Server software: Apache/2.2.15 (CentOS)
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery UI, SuperFish, Twitter Button
      Number of Javascript: 5
      Number of meta tags: 5
    8. eKaizen | Moving the face-to-face sales experience online
      Boardman (United States) - 52.38.243.6
      Server software: nginx/1.4.6 (Ubuntu)
      Technology: Carousel, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, SuperFish, Wordpress
      Number of Javascript: 32
      Number of meta tags: 4
    9. trackerlocate.com
      Wayne (United States) - 74.208.136.111
      Server software: Microsoft-IIS/7.5
      Technology: Javascript, Php
    10. 영진약품공업주식회사
      Korea, Republic of - 211.60.219.105
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1

    Check Other Websites